SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027638 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027638
Domain Number 1 Region: 17-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.01e-23
Family Ubiquitin-related 0.0000243
Further Details:      
 
Domain Number 2 Region: 513-560
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000535
Family UBA domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027638
Domain Number - Region: 111-166
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000549
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 
Domain Number - Region: 187-237
Classification Level Classification E-value
Superfamily ARM repeat 0.0144
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027638   Gene: ENSMODG00000011445   Transcript: ENSMODT00000029178
Sequence length 565
Comment pep:known_by_projection chromosome:BROADO5:4:352719305:352721356:-1 gene:ENSMODG00000011445 transcript:ENSMODT00000029178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSGEVPPRASPASTTDPHIIKVTVKTPKDKEEFAVQDTCTIQQLKKEISQRFKAHPDQ
LVLIFAGKILKDPDSLVQCGIRDGLTIHLVIKMQKRGGGPECLAPSQPALPPPPPPPPPP
VPLHPGGAHPFSLGVLTGLNGLGLTSGSFPDLQSQLLWQHISVPELVAQIIDDPFIQGLL
SNTGLVRQLVLDNPYMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMMRSQDRAL
SNLESIPGGYNALRTMYTDVMDPMLNAVQEQFGGNPFAAAATTSSATNSGCSQPSRTENC
DPLPNPWATHYGITAGGQDRQHGGQDSRHIPLRSDPQEGSPGFPSIGLTGYLQQLLEPPQ
GLGAYLQGPASLGLSQEPSPTTLPPRTVPMDTSTRGALQFQEEMQRQLPLLVHLQAAMAN
PRALQALLQIENGLQTLATEAPRLLLWFSPSLGVLGIPSFMPGAEMGSCPLNNPTSVVNP
EECPETVARTVSSGQGLAEMLQVLTNTGPQLQSSPLQQPEAQFQPQLEQLHAMGFLNPEA
NLQALIATEGDVDRAVEKLRESQIS
Download sequence
Identical sequences F6Q0U8
ENSMODP00000027638 13616.ENSMODP00000027638 ENSMODP00000027638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]