SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027685 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027685
Domain Number 1 Region: 46-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-35
Family SCAN domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 436-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027685   Gene: ENSMODG00000016201   Transcript: ENSMODT00000029223
Sequence length 495
Comment pep:novel chromosome:BROADO5:6:155279105:155292611:-1 gene:ENSMODG00000016201 transcript:ENSMODT00000029223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALESRETAALDPAWKEGLQVVKVKVEEEEDYLWGKKGIQKRNSPSTQETSRLRFRQFGY
SDTPGPRDALNKLRELCHQWLKPEIYTKEQILELLVLEQFLTILPEALQTWVRDQHLENA
EEVVTVLEDLERELGESGRQVVSSIPREAGACEKMAPLRTAQDALNVQPMNIQIKCGSPE
PQFLQERDFEIGIKWSLPKQEFSEAVESKEKISGRFPVDVSQGAKTEEAYECEGTLSKQQ
ENKMEKVDGSLSQDGNYMLVTIPAEKIPLGENGHKYDECLCSCHLNSNLVAQQRVPTGEK
LDISATNDQNSRQNSSSSVHQINQTVQKSFECNECEKTFKQNSELRKHQGIHIGVKPHKC
TQCGKAFSRRSYLRKHQKIHTGVKPYSCSECGKAFRVSSDLIQHQRIHTGDKPYHCRECG
KAFNQNSSLIQHQRIHTGEKPYECDECGRAFNQRSALTQHQRIHTGEKPYECKECGKPFR
HWSGLMTHRRVHTKL
Download sequence
Identical sequences F6PYG5
ENSMODP00000027685 ENSMODP00000027685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]