SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027792 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027792
Domain Number 1 Region: 404-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000225
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 437-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000847
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027792   Gene: ENSMODG00000014569   Transcript: ENSMODT00000029329
Sequence length 473
Comment pep:known_by_projection chromosome:BROADO5:6:186492058:186497640:-1 gene:ENSMODG00000014569 transcript:ENSMODT00000029329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPPGEFDMALSGTLLPSISTFAAGTPGKEKVLRQAGAPNNRWREELSHMKRLPSSNGG
GGANNNPALLSRREAEEFNDLLDFDFILSNSLIHQEPATAAVVSSASASASASSSPSSSG
PASAPPANCSFTYPLRGAGDPGGTTSNGGGGGLLYSREPAPPPAAPFNLADINDVSPSGG
FVAELMRPDLDPVYIQQQQLSGGSLHGKFVVKATLNMGEYNGQSIISVNKGNLSSCSPDG
SHPVVVAPYSTGPRMCPKIKQEAVSSCTIGRPMEAHLGSGPPLSNGQRSQPHEFPLGRPL
PSRTTPSLTAEELMNSRDCHPSPQGISHPLSIPPGFHPGPNYPPFLPDQLQPQVTPLQYQ
ELIPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPY
HCDWEGCGWKFARSDELTRHYRKHTGQRPFQCQKCDRAFSRSDHLALHMKRHF
Download sequence
Identical sequences F6RH60
ENSMODP00000027792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]