SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027838 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027838
Domain Number 1 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 10-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.00076
Further Details:      
 
Domain Number 5 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 125-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027838   Gene: ENSMODG00000013671   Transcript: ENSMODT00000029375
Sequence length 389
Comment pep:novel chromosome:BROADO5:6:199918034:199921155:-1 gene:ENSMODG00000013671 transcript:ENSMODT00000029375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVKRSKTVLVFQESVTFKDVAMYFTQEEWGQLDSVQKDLYRDVMLETYKNLVSLGWKTRY
ITNDSISEVESPNAREQFIRIIPQGFRCEELDAEKWLSRKRESFIGETQKKYISQERFDI
NGKISEITEHQRIHTGERDYECNICGKTFPKHSHLVQHQRIHTGEKPYQRNECGKAFNQI
TCLTEHQRIQTGEKPFKCNECKKAFQKQSALTQHQRIHTGEKPYKCNECGKSFSHSSILT
QHQRIHTGEKPYKCNECGKDFRNHSHLTQHQRIHTGEKPYKCNECGKVFNQSACLTQHQR
IHTGENPFKCKECGKAFSHSSSLSEHQRTHTGEKPYKCNECGKDFRNHSHLTQHQRIHIG
EKPYKCNECEKAFSCSSALIRHQQLHRGE
Download sequence
Identical sequences F6VGH3
ENSMODP00000027838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]