SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027844 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027844
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.43e-36
Family SCAN domain 0.0000767
Further Details:      
 
Domain Number 2 Region: 691-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-27
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 635-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-27
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 298-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.07e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 9 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 10 Region: 131-189
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000327
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Domain Number 11 Region: 263-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000133
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027844   Gene: ENSMODG00000013677   Transcript: ENSMODT00000029381
Sequence length 769
Comment pep:novel chromosome:BROADO5:6:199827636:200018007:1 gene:ENSMODG00000013677 transcript:ENSMODT00000029381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGEVRKAICLAPQLLGAQEKRDNAWGPGSSLQQDSQLSCEVFRQHFRQLCYHETSGPQE
ALGQLRDLCGRWLRPDMNTKMQILELLVLEQFITILPGEIRAWVQLHRPESGEEAVAMVE
DFQKQLDGSGQKDLVTFEGVSADFTEKEWKGSAPAQRAFFRDLMLENYRDVVSLEGDNVT
ENEENTSKQEIFVESELHNNSSENLQKDLCQGTEGGEACEMENMLEQQQGTLSQEKIKRI
DSDFMEVIVQNKKIPVEERDEKHKEFWKSFDLITNTVTHEKVPRGQKSYQCNECGKYFNR
SSHLIGHQRIHTGEKPYECNECGKSFRQTSQLIVHLRIHTGEKPYECNECGKAYRHSSHL
IHHQRLHNGEKPYKCNECVKAFTQSSQLIDHQRIHTGEKPYECNMCGEAFSRSKSLIRHQ
ILHTGEKPYKCNECGKAFCSNRNLIDHQRTHTGEKPYQCNECGKAFSRSKCLIRHQSLHT
GEKPYKCSECGKTFSQGSQLIDHERIHTGEKPFACSECGKAFSLSKSLIRHQRLHTGERP
YKCNDCGKSFNQNSHLIIHQRIHTGEKPYECNECGKVFSYSSSLLVHKRTHTGEKPYECH
ECGKAFSDSSQLIVHQRIHTGEKPYECKECGKAFSFSQRSHLIRHQRIHTGEKPYECNEC
GKTFSQRSNLTVHQGIHTGEKSYECDECGKAFHRSSGLTVHQRIHTGEKPYECNECGKAF
SCSSYLIVHQRIHTGEKPYQCNVCGKAFSQNSHLILHQSTHSRKKHQIP
Download sequence
Identical sequences F6VFS2
ENSMODP00000027844 ENSMODP00000027844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]