SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027893 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027893
Domain Number 1 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 357-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 622-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 191-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027893   Gene: ENSMODG00000023027   Transcript: ENSMODT00000029472
Sequence length 683
Comment pep:novel chromosome:BROADO5:1:746205874:746211807:1 gene:ENSMODG00000023027 transcript:ENSMODT00000029472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFRDVAVDFTREEWRLLSPPQKELYKVVMLENARNLFSVGLPAPPEDVLSSLEQREAPW
MLEQEGPRSSCPGKGGEESQACICLLGERPEYKDPGKAYPKSKIYYEEPLRSHGMLFVIQ
IVFYGGKEIVIYVCMSLYMFYCLFLLEGEIRSQMKSNPTDMSLPVEKIDQHRFMSDGPDN
FTFREFCVASRNSSHIEHQRMHTEEKSSESNHCGKTFMRRASLAGHQRVHTGEKPYECKQ
CGKTFTDNSNLAKHQRIHTGEKPYECKYCGKTFCRSSSLAVHERVHTGEKPYECKQCGKT
FRHSSSLAVHQRIHTGEKPYECKQCGNTFICSSSLAVHERVHTGEKPYQCKECGKIFKQC
STLAVHQRMHTGDRPYKCKQCGKTFSQSSYLAVHRKIHSGQKPYKCKHCGKTFSLSSYLA
VHERVHTGEKPYECKQCGKTFSRSSSLAPHERVHTGEKPYKCKECGKTFSQSSYLAVHQR
IHTGEKPYECKQCGNTFSCSSSLAVHERVHTGERPYECKQCGKTFCQSSELAVHHRIHTG
EKPYECKQCGKTFRLSSQLSVHERVHTGEKPYECKQCGKTFRLNSDLVVHNRIHTGEKPY
ECRQCGKIFSQRSTLAVHHRIHTGEKPYECKQCGKTFSRSSSLGRHERIHTGEKPYQCMH
CGKTFSRNSNLAVHQRIHTGEEP
Download sequence
Identical sequences F6UXG2
ENSMODP00000027893 ENSMODP00000027893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]