SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027907 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027907
Domain Number 1 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 632-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 716-773
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 407-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 758-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 183-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 13 Region: 130-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000206
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 14 Region: 679-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000189
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027907   Gene: ENSMODG00000023028   Transcript: ENSMODT00000029486
Sequence length 814
Comment pep:novel chromosome:BROADO5:1:746099944:746142710:-1 gene:ENSMODG00000023028 transcript:ENSMODT00000029486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFRDVAVDFTREEWRLLSPPQKELYKEVMLENVRNLLSVGLPAPPKDMILEQREAPW
MLEQEGLRCYCPVPSKSPLKSIQDYLQKTIFSKTISSKGVHLPLEEMDLQRFMSDGLDNV
ASREFCVAPQNSSHNEYQRMYTEEKSIESNQCRETVMHRASLFGHQRMHTGEKPYECKQY
GKTFSHSSGPVNHQRKHIGEKPYECKQCGKRLRRSSGLASHQRMHTVEKSYECKQCGKTF
NRISDFAYHQRMQTRGKFYECKQCGKTFSHSSGLTYHQRMHTGEKPYGCKQCGKTFSQSS
DLAVHQRMHTGEKPYVCKQCGKAFGWSSGLAYHQRVHTGEKPYECKQCGKTFTQSSSLAY
HQRMHTGEKPYECKQCGKTFNRSSGLASHQRVHTGEKPYECKQCGKTFSHSSGFTYHQRV
HTGERPYECKQCGKTFTQSSGLASHQRRLHTGDKPFECKQCGKTFSRSCDLAVHQRVHTG
EKPYECKQCGKTFSQSSGLASHQRMHTGEKPYECKQCGKTFSHSSGLAYHKRLHTGEKPF
ECKRCGKTFSRSSDLAVHQRVHTGEKPYECKECGKTFSRSSGVAYHQRVHTGEKPFECKQ
CSKTFSHSSGLAVHQRKHTGEKPYECKQCGKTFSRSSDFAIHQRMHTGEKPYECKQCGKM
FSHSSSLVVHQRMHTGEKPYECKQCGRTFSHSSGFAYHQRVHTGEKPYECKQCGKTFSQS
CDLAYHQRVHTGEKPYKCKLCDKTFIQRSGLAYHQRIHTGEKPYECKQCGKTFRWSSGLA
VHQRMHTGEKPYECKECGKTFSHSSGLAYHQRMH
Download sequence
Identical sequences F6TH24
ENSMODP00000027907 ENSMODP00000027907 13616.ENSMODP00000027907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]