SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027933 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027933
Domain Number 1 Region: 225-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-19
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 9 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 606-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027933   Gene: ENSMODG00000023031   Transcript: ENSMODT00000029512
Sequence length 663
Comment pep:novel chromosome:BROADO5:1:745583264:745588149:-1 gene:ENSMODG00000023031 transcript:ENSMODT00000029512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFRDVAVDFTREEWRLLSPPQKELYREVMLENVRNLLSVGKEWQRQSIREMLSDCLA
KVRSIMRHIFKYGKCHIFVEILTEMRDYKIKGTFSLHAHRETRSEMKVNPREVSLLLEEM
DLQRFKSDGLDKFAAVQFCVAPQNSSDNEHQRMYTEEKSIESILCRDTFMQRANLFGHQR
MHTEEKPYECKHCGRIFSHRFALVGHQRMHTVEKPYECKRCGRIFSHRSALVVHQRIHTG
EKPYECKQCGKTFTRSSGLASHQRMHTGEKPYECKQCGKTFSHTSSLTVHQRMHTGKKPY
ECKQCGKTFHYRSALAVHQRIHTGEKPYECKQCGKTFTQSSGLAYHQRMHTGEKPYECKQ
CGKTFSHTSSLTIHQRVHTGEKPYECKQCGKTFSYTSSFSVHQRIHTGEKPYECKQCGKT
FSHTSILSVHQRMHTGEKPYECKECGRSFSHSSDLVVHQRIHTGEKPYECKQCGKTFTQS
SGLASHQRMHTGEKSYKCKPFGKTFTQSFHLAHHHRMHTREKPYDCKQCGKSFSHASRLS
VHQRVHTREKPYECKQCGKTFGHTSSLSVHQRMHTGEKPYECKKCGKTFSHASSLSVHQR
VHTREKPYECKQCGKTFGHASSLSVHQRVHTREKPYECKQCGKTFGHTSSLTVHQRMHTG
EKP
Download sequence
Identical sequences F6SJU3
ENSMODP00000027933 ENSMODP00000027933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]