SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027935 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027935
Domain Number 1 Region: 144-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 92-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 298-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 328-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000214
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027935   Gene: ENSMODG00000008381   Transcript: ENSMODT00000029514
Sequence length 386
Comment pep:novel chromosome:BROADO5:1:745449241:745453730:-1 gene:ENSMODG00000008381 transcript:ENSMODT00000029514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTFQDVAVDFTQEEWRLLSPPQKELYKEVMLENARNLLSVETSLSKQGLLSSPGEEAET
PLEKSPQGSESCEAGKSRQGEGIKADPSRSLQSSSLVHQRIHSGKKTYVCKQCGKSFSQS
SSLVVHERIHTGEKPYECKQCGKSFSQSSHLGRHQRIHTGEKPYECKQCGKTFRRSSHLA
VHQRIHTGERPYECNQCGKTFTKNSNLVVHLRVHTGEKPYECKQCGKPFGLRSSLAVHQR
IHTGEKPYQCKQCGKSFRLCSDLVVHQRIHTGERPYECNQCGKTFTKNSNLVVHLRVHTG
EKPYECKQCGKPFRLSSNLAVHQRIHSGEKRNECKKCGKTFMECSSFPGHRRFHSGEKPH
ECNQCGKTFSQFSNLALHQSIHMGRN
Download sequence
Identical sequences F6SJS4
ENSMODP00000027935 13616.ENSMODP00000027935 ENSMODP00000027935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]