SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027943 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027943
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.89e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 18-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 492-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-23
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 8 Region: 708-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 754-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 440-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 12 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000094
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 13 Region: 277-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000074
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 14 Region: 361-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000762
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027943   Gene: ENSMODG00000023033   Transcript: ENSMODT00000029522
Sequence length 811
Comment pep:novel chromosome:BROADO5:1:745406873:745415210:1 gene:ENSMODG00000023033 transcript:ENSMODT00000029522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSFAFYLPQLLLLSLELWKELVTFRDVAVDFTREEWRLLSPSQKELYREVMLENVRNLL
SVGLPAPPEDVISSLEQREAPWMLEQEDLRSCSPGEGEKGIQCLGLKHLEPMSRRADCCL
IWKRSEAKLSLTNQPRPFPDFWGSVFIRPEMKANPTELSLPVEEIGPNSFAFREFFVSLQ
NSSQIEIHTEEKSSKSNQCKKTLMRRANLAVHQRIHSVEKPYECNQCGKTFKERSKLSVH
QRIHTGEKPYECKQCGKTFCQSFSLTVHQRIHSGEKPYECKQCGKMFSQSSNLAVHQRIH
TGEKPHKCKQCGKTFSHSSHLAVHYRVHTGEKPYECNQCGKTFSRSSSLAVHQRIHTGEK
PYECKQCGKTFIVGSSLTVHQRMHTGEEPYECKQCGKAFTNSSSLVTHQRIHTGEKPYEC
KHCGKTFSRSSYLAEHQRIHTGEKPYKCKQCGKTFSQNSHLAVHQRIHTGEKPYKYYECK
HCGKAFTNNTNILHQRIHTGEKPYECKQCGKTFSRSSYLVEHQRIHTGEKPYECKQCGKT
FSQSSHLAVHWRIHTGEKPYECKQCGKTFTNNSSLSVHQRTHTGEKPYECKQCGKTFSQS
SNLAVHQRIHSVEKPYEYKHHGNTFSQFSNLGIHQRNHTVEKPYECKLCGKTFTTNSSLF
VHQRIHTGEKPYQCKQCGKTFRQSSNLAVHQRIHTGEKPYQCKHCGKTFSHSSHLAVHCR
IHTGEKPYECKQCGKTFSRSSSLAVHKRIHTVEKPCECKQCGKTFSQNSHLAVHQRIHTG
EKPYQCNQCGKTFSRSSSLAVHQRIHTRKDP
Download sequence
Identical sequences F6SIX0
ENSMODP00000027943 13616.ENSMODP00000027943 ENSMODP00000027943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]