SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027946 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027946
Domain Number 1 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.32e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 87-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 23-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 141-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 2-32
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000052
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027946   Gene: ENSMODG00000016758   Transcript: ENSMODT00000029525
Sequence length 572
Comment pep:novel chromosome:BROADO5:1:745213361:745215442:-1 gene:ENSMODG00000016758 transcript:ENSMODT00000029525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SECNQCKKTFMHRSSLAGHQRIHTGEKPYECRQCGKTFRLSSSLAVHQRIHSGEKPYECK
QCGKTFSQISHLIKTYECKKYGKTSTHSYALALHQRIYSGEKPQECKQCGKKFRYSYSLA
VHQRIHTGEKPYECKQCGKMFSGILSLAVHQRIHSGEKHECKQCGRTFNRSCSLGIHQKI
HTGEKPYECKQCGKTFRLSSRLAVHQRIHTGEKPYECKQCGKPFRNSSSLGRHQKIHTGE
KPYECKQCGKTFSRSYNLAQHQRIHTGEKPYECKQCGKTFRVSSSLSQHLNIHTGEKPFE
CKQCGKAFISSTLAEHQRIHSGEKPYECKQCGKTFRNSSSLGRHQRIHTGEKPYECKQCG
KTFSRSCNLGIHQRIHTGEKPYECKQCGKAFRGSSSFAIHQRIHTGGEIHECKQCGKTFS
RSCSLVIHQRIHTGEKPYECKQCGKAFSQSSSLAKHQRVHSGEKPYECKECGKTFRSRPS
LAYHQRIHTGEKPFECKQCGKAFRGSSYLAIHQRTHTEEKPYECKQCGKEFRGILSLAVH
QRIHTGEKPYACKQCGKTFSRSCSLGIHQKIH
Download sequence
Identical sequences F6SIU6
ENSMODP00000027946 13616.ENSMODP00000027946 ENSMODP00000027946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]