SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027967 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027967
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.06e-36
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 200-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000518
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027967   Gene: ENSMODG00000016810   Transcript: ENSMODT00000029546
Sequence length 294
Comment pep:novel chromosome:BROADO5:1:739815551:739824345:-1 gene:ENSMODG00000016810 transcript:ENSMODT00000029546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDPEASRHNFRHFRYTQASGPRKALSQLRGLCLQWLRPEIHTKQQIMELLVLEQFLIILP
REIQAWVKSQHPDNSEEVVTLLENLAQVLEGGGRIFPVGRGDRLCQFSGLSPLSPSLPPS
VDRRLSKCMTGRETSRRSLGGIGPGPASIKSDQLSGGKRNRGELGGSEEIHSGVCCLCPG
HAHGPPRQKWGCSENTGVLQTSRIRVGPKAYKCKECGETFSDCSTCIRHQRVHTGEKPYR
CAECGEAFTRGTSLTEHRRTHTGEKPYACRACDKAFTRRSSLVKHQRVHTGEKP
Download sequence
Identical sequences F6S134
ENSMODP00000027967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]