SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028028 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028028
Domain Number 1 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 3-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-22
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 8 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 603-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 663-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000609
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028028   Gene: ENSMODG00000023048   Transcript: ENSMODT00000029607
Sequence length 733
Comment pep:novel chromosome:BROADO5:1:715088939:715094838:-1 gene:ENSMODG00000023048 transcript:ENSMODT00000029607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLVFQETVTFQDVAVEFTWEEWGHLNPSQKKLYSDVMLENYKNLVSLGKNSYSFGVFIYR
ERLSRLISFSSSLYFLALSTPFFSQGELELLSDMTHFLIFLLYSLCCTSLAISFPHFKLI
NSPFSFYSLLKWEGKRMSLKPLSNEQPWKREEKSVLIGSLFFLSESKEHPEEKPYKCSKC
GKAFKNKTQLIMHQRIHSGKIFYECKECGKEFHRNSDLIKHQRIHTGEKPYECTECGKTF
RMKAYLIVHQRIHTGEKPFECCECRKAFSMKAYLIVHQRIHTGEKPYECSQCGKAFRRKP
HLNEHQRIHTGEILYECKECGKAFHKNSGLIRHQRIHTEEKPYEWSECGKTLRRKAQLTL
HQCIHSGERPYECNECGKAFRRKVYLIEHQRIHTGEKPYECNDCGKAFRMKAYLIVHKRI
HTGEILYECKECGKAFDRKSDLIQHQRIHTGEKPYECKECRKAFRRKSKLTEHQRIHTGE
KPYKCNACGKAFRQRTQLYVHLRIHTGEIPHECKECGKAFVYNSELIKHQRIHSGEKPYE
CNECGKAFRKKSYLTLHQRVHTGEIFYECKECGKSCLYNSDLIVHQRIHTGERPYECKEC
GKSFKQRTQLTQHQSIHTRERPYECKECEKTFKLRTHLAQHERIHSQTKPHECNECGNTL
QLRTQLVQHQSIHTRERPYECNECWKTFRLKICLKTKLTLHQRIHTEKSYECNECGKAFR
RKEHTTVNQRINT
Download sequence
Identical sequences F7DCN0
ENSMODP00000028028 ENSMODP00000028028 13616.ENSMODP00000028028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]