SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028044 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028044
Domain Number 1 Region: 198-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-27
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 618-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 660-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 11 Region: 145-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 469-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000261
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028044   Gene: ENSMODG00000023050   Transcript: ENSMODT00000029623
Sequence length 721
Comment pep:novel chromosome:BROADO5:1:714345278:714352592:1 gene:ENSMODG00000023050 transcript:ENSMODT00000029623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTFKDVAVDFTREEWRLLSPPQKELYKEVMVENIRNLLSVGIGNRTKSFMPWINAKKSA
EFLHLILDTGRKNKVKSNYNGNYMMLTEKLDDEIMEIFSLHYPVDFRSSHSSSLSEVMVL
KMGLQRFMSDGPNNFAFREFCVASQNSSHIKHQRMHTEEKSTESNQFRKTFIHRANLSGH
QRVHTGERPYECNQCGKTFSQSSSLAVHQRVHTGERPYECNQCGKTFSQSSSLAVHQRIH
TGEKPYKCKQCGKTFTNNSSLAVHQRVHTGEKPYECKLCGKTFSQSYSLAIHQRIHTGEK
PYECNHCGKTFTNNYGLAVHQRVHTGEKPYECNQCGKTFTNNYSLAVHQRVHTGEKPYEC
KQCGKTFSRSSHLAVHQRIHTGKKPYECKQCGKTFTNNSSLAVHQRVHTGEKPYECKQCG
KTFHQSSHLAVHERVHTGEKPYECKQCGKTFRQSYSLALHQRIHTGEKPYECKQCGKTFI
NNSSLAVHHRVHTGEKPYKCKQCGKTFSRSSHLAHHQRIHTGEKPYECKQCGKTFHQSSY
LAVHQRVHTGEKPYECKQCGKTFSQSYSLALHQRIHTGKKPYECSQCRKTFCQSSDLTHH
QRIHTGEKPYECKQCGKTFRLRSSLSHHQRIHTGEKPYECKQCGKTFRLRSHLAHHQRIH
TGEKPYECKQCGKTFRQSSHLVVHQRIHTGEKPYECKQCGKTFSQSFDLAVHQRIHTGEK
P
Download sequence
Identical sequences F7CT77
ENSMODP00000028044 ENSMODP00000028044 13616.ENSMODP00000028044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]