SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028058 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028058
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 202-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 89-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028058   Gene: ENSMODG00000023053   Transcript: ENSMODT00000029636
Sequence length 412
Comment pep:novel chromosome:BROADO5:1:713944545:713951450:1 gene:ENSMODG00000023053 transcript:ENSMODT00000029636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEVTFKDVAVDFTREEWCLLSPPQKELFKEVMLENIRNLLSVGKESSPCCPNVLSFLEQR
EAPWMLDQEVLRSYYPGKGGEKRCERAKTFRRKFDHAVHQRVHTVEKSYECKQCGKTFRW
GFELAVHHRVHTGEKPYECNQCGKSFRQSFKLTVHQRVHTGEKPYECKQCGKTFTNNSSL
AVHQRVHTGEKPYECKQCGKKFTNNSSLTVHRRVHTGDKPYECKQCGKTFINNSGLTVHQ
RVHSGEKPYECNQCGKTFTNNSSLAVHQRVHTEEKPYECKQCGKTFRQSFKLTVHQRLHT
GEKPYECKQCGKTFTNNSSLTVHQRVHTGEKPYECKQCGKIFTNNSSLTLHQRVHTGEKP
YECNQCGKTFTYNSSLVVHQRVHTGEKPYECNQCGKTFTNKSSLVVHQRVHI
Download sequence
Identical sequences F7C9S0
ENSMODP00000028058 ENSMODP00000028059 13616.ENSMODP00000028058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]