SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028059 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028059
Domain Number 1 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 105-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000159
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028059   Gene: ENSMODG00000023053   Transcript: ENSMODT00000029637
Sequence length 378
Comment pep:novel chromosome:BROADO5:1:713944545:713951621:1 gene:ENSMODG00000023053 transcript:ENSMODT00000029637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEVTFKDVAVDFTREEWCLLSPPQKELFKEVMLENIRNLLSVGKESSPCCPNVLSFLEQR
EAPWMLDQEVLRSYYPGKGGEKRCERAKLSLNHQFQALSGSLWLSLFHIGEKPYECNECG
KTFRRKFDHAVHQRVHTTFINNSGLTVHQRVHSGEKPYECNQCGKTFTNNSSLAVHQRVH
TEEKPYECKQCGKTFRQSFKLTVHQRLHTGEKPYECKQCGKTFTNNSSLTVHQRVHTGEK
PYECKQCGKIFTNNSSLTLHQRVHTGEKPYECNQCGKTFTYNSSLVVHQRVHTGEKPYEC
NQCGKTFTNKSSLVVHQRVHIEEKPYECNQCGKTFRQSFKLTVHQRVHTGEQPYECKQCG
KAFSQRSHLSHHQRIHTG
Download sequence
Identical sequences F7C9R4
ENSMODP00000028059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]