SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028068 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028068
Domain Number 1 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 568-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 624-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 793-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 119-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 11 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 680-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 175-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 14 Region: 835-887
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 15 Region: 77-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 16 Region: 2-42
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-16
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 17 Region: 41-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000975
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028068   Gene: ENSMODG00000023055   Transcript: ENSMODT00000029646
Sequence length 893
Comment pep:novel chromosome:BROADO5:1:713592925:713668691:1 gene:ENSMODG00000023055 transcript:ENSMODT00000029646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFKDVAVDFTQEEWCLLSPPQKELYKEVMVENAQNLLSQCGKAFSRKSHLATHLRVH
TGEKPYECKQCGKTFIHTGEKPYECQQCGKTFRYNSKFTVHQRIHTGEKPYECKQCGKAF
RQRFELAVHHRIHTGEKPYECKQCGKSFRQRSNLTIHQRVHTGEKPYECKQCGKAFSQNS
SLALHQRIHTGEKHYECKQCGKIFTYNSELSLHQRRVHTGKNLFECKECGKSFSRRSHLA
IHQRIHTGEKPYACNECEKTFTNSSSLSVHQRVHTGEKPYKCKQCGKAFSQKSHLVIHQR
IHTGEKPYECKQCGKAFRRSFELAVHQRVHTGEKPFECNQCQKIFRQGYELAVHQRIHTG
EKPYECKECGNAFSRSSKLAVHQRLHTGEKPYECNECGKTFTNCSSLAVHQRVHTGEKPY
ECKQCGKTFNWTSKLVVHQRIHTGEKPYECKECGKTFTNSSSLAVHQRIHTSKRPYDCKQ
CGKAFSRRSHLALHQRIHTGEKPYKCKQCGKSFSHKSHLAVHQRIHTGEKPYECNQCGKT
FTDSSSLAVHQRVHTGEKPFECKQCGKMFRQSSELTVHQRVHTGEKPFECKQCGKAFSQK
SHLATHQRIHTGEKPFECKQCGKTFTYHSSLVLHQRVHTGEKPFECKQCGKTFRQSSHLA
VHQRIHTGEKPYECKQCGKTFRQSFELVLHQRIHTGEKPYELNQCGKIFTNSSSLAVHQR
RVHSGEKPYQCKQCGKTFSSRSYLAVHQRVHTGEKPYQCKQCGKTFTYNSKLAVHQRVHT
GEKPYQCKQCGKTFSSRSYLAVHQRIHTGEKPYQCKQCGKTFTYNSKLAVHQRVHTGEKP
YKCKQCGKTFTYNSKLVIHQRVHTGEKPYQCKQCGKTFSSRSYLAVHQRVHTG
Download sequence
Identical sequences F7C993
ENSMODP00000028068 ENSMODP00000028068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]