SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028072 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028072
Domain Number 1 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 934-991
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 878-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 654-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 990-1047
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 710-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 12 Region: 822-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 13 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 14 Region: 1046-1103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.84e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 15 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 16 Region: 766-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 17 Region: 597-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 18 Region: 1088-1140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 19 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 20 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028072   Gene: ENSMODG00000023056   Transcript: ENSMODT00000029650
Sequence length 1145
Comment pep:novel chromosome:BROADO5:1:713340479:713388331:1 gene:ENSMODG00000023056 transcript:ENSMODT00000029650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFKDVAVDFTQEEWRLLSPPQKELYKEVMLENAQNLLSVGKESSPPEVVLSYLEQSEAP
WMLEEEGLRTYCPGKGREKWYPESHSDDPERKDFRRSFELAVHHRVHTGEKSYECKQCGQ
TFRQNFELAVHQRIHTGGKPYKCNQCGKTFTNNSSLAVHHRVHTGEKPYDCKQCGKAFSR
RSDLAIHLRIHTGEKPYECNQCGKTFTNSSSLAVHQRVHTGEKPYECNECGKTFSHRSHF
AIHQRVHTGEKPYECNQCGKTFTNSSSLAVHQRVHTGEKPYECKQCGKAFSQSYKLAVHQ
RVHTGEKPYECKQCGKAFIQSYKLAVHQRIHTGEKPYECKQCGKTFRRSFELAVHHRVHT
GEKPYECKQCGKTFRQNFELAVHQRIHTGERPYKCKECGKAFSRSSRLFVHQRIHTGEKP
YECNECGKTFANTSSLAVHHRVHTGEKPYECNQCGKTFRQSSNLAVHHRVHTGEKPYECK
QCGKAFSQRSRLAVHQRIHTGEKPYECNQCGKTFRQNSKLVAHQKIHTEEKPYECNECGK
TFTNNSSLAVHHIIHTGEKPYECKQCGKTFTNNSSLAVHQRIHTGEKPYECKQCGKTFRL
SCELTTHQRVHTGEKPYECKQCGKAFSQRSHLAVHHRRIHTGMKPYDCNQCGKTFTNNSS
LAVHQRVHTGEKPYECNQCGKTFTYNFNLAVHQRIHTGEKPYDCKQCGKTFRRSFELAIH
QRIHTGEKPYECKECGKAFNQSSSLTLHQRIHNGKKPYECKECGKTFSQNSHLTVHWRIH
TGEKPFECKQCRKTFRRSFELAIHQRTHTGEKPYECKQCGKTFRRSFYLAVHHRVHTGEK
PYECNECGKTFSNNSSLTVHQKIHTGEKPYECNQCGKTYTYNSNLVVHQRVHTGEKPYEC
NQCGKTFTYNSNLAVHHRVHTGEKPYECNQCGKTFTYNSSLAVHQRVHTGEKPYECKQCG
KTFSRSSKLALHQRVHTGEKPYECKECGKTFNQSSSLTLHQRIHNGKKPYECKECGKTFS
QNSHLTVHQRIHTGEKPFECKQCGKTFRRSFELAIHQRIHTGEKPYECKQCGKTFRRSFY
LAVHHRVHTGEKPYECNECGKTFSNNSSLAVHQKIHTGEKPYECNQCGKTFTYNSNLAVH
QRVHT
Download sequence
Identical sequences F7C8V3
ENSMODP00000028072 ENSMODP00000028072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]