SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028083 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028083
Domain Number 1 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 119-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 553-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 2-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-17
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028083   Gene: ENSMODG00000023057   Transcript: ENSMODT00000029661
Sequence length 606
Comment pep:novel chromosome:BROADO5:1:713287528:713295224:1 gene:ENSMODG00000023057 transcript:ENSMODT00000029661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTFKDVAVDFTWEEWCLLSPPQKELYKEVMLENAHNLLSVGKEPNSCCPSQPSKGMLPS
ASLVFTKLEKEINLLLQYWGMGMHLIPQGNQELEETKSYALDKCQKEMYTEEKSSESNHF
SLALHQKIHNGKKPYECKQCGKVFSSRSHLAVHQRIHTGEKPYECKQCGKTFTNNSSVAI
HQRVHTGEKPYECKQCGKTFSQRPHLAAHQRVHTGEKPYECKQCGKAFSRRSHLAVHQRI
HTGEKPYECKQCGKTFRWNSKLAIHNRIHTGEKPYECKQCGKTFRQTFELAVHQRIHTGA
KPYECNQCGKTFANNSSLAVHQRVHTGEKPYECSQCGKTFTYNSSLAVHQRVHTGEKPYE
CKQCGKTFSRSSKLALHQRIHTGEKPYECKQCGKTFNQSSSLALHQRIHSGKKPYECKEC
GKTFSQNSHLAVHQRIHTGEKPFECKQCGKAFSRRSYLAIHQRIHTGEKPYGCKQCGKTF
RRSFELAVHQRVHTGEKPYECNQCGKTFTSNSTLAVHQRVHTGEKPYECNQCGKTFTYNS
NLAVHRRVHTGEKPYECNHCGKTFTYNSSLAIHRRVHTGEKPYECKQCGKTFSKSSHLSH
HKRIHT
Download sequence
Identical sequences F7BQR8
ENSMODP00000028083 ENSMODP00000028083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]