SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028100 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028100
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 517-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.92e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.46e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 562-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 191-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000263
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028100   Gene: ENSMODG00000013749   Transcript: ENSMODT00000029678
Sequence length 621
Comment pep:novel chromosome:BROADO5:1:712257005:712264070:-1 gene:ENSMODG00000013749 transcript:ENSMODT00000029678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTFQDVAVDFTREEWGQLDPAQKNMYRDVMLENYENFISLAGLPVPKADVISHLEKREA
SWTLRGKFLKNPSLDSLVLQTRYDTKDPIPEFISTEKSSKEQLTKNGSWNSKLGEPWDCE
GRLEREKSDHEKESRQVTIPNRKSFIELNAQDYNTFGAILTLPERVPLKKCLHKNDTLGK
SFKPFSDPIKHNIILGKKLCKYNKCRKSFSYHSNLIHYYRIHTRGKPHKCNECGKVFSIN
SCLTVHKRIHTGERPYTCNECGKAFSQKGNLKRHKLIHAGKKPFECNECGKAFSSNEYLT
QHQRIHTGEKPYKCNECGKTFSQKGSLNVHKRIHTGEKPYKCNDCGKAFSQKRSLDAHKI
IHSGETLCSCNECGKTFSNNFHLNIHKIIHTGEKPFECNVCGKSFSSNHYLSQHQRVHTK
EKPYKCSDCGKAFSQKGSFNVHKRIHTGEKPYKCNECGKAFSQNRSLKVHMIVHTGEKPW
SCNECEKTFMNSAYLNIHKKIHTREKHFECNECGKNFRHSSYLLQHQRMHTGEKPYKCNQ
CGKAFSRKGSLNAHKRIHTGEKPFECNECGKAFSQKGNLNTHKKTHTGEKPFECNQCGKS
FRLRQAFAAHRKIHTIEKPFE
Download sequence
Identical sequences F6Z0T7
ENSMODP00000028100 ENSMODP00000028100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]