SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028176 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028176
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 377-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 534-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 12 Region: 152-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 13 Region: 115-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028176   Gene: ENSMODG00000008031   Transcript: ENSMODT00000029757
Sequence length 743
Comment pep:novel chromosome:BROADO5:1:668982108:669016130:1 gene:ENSMODG00000008031 transcript:ENSMODT00000029757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIYHSQKIQKSLVTFKDVAVDFTKEEWRNLDPSQKELYRDVMLENYRNLVFLAGLTVWKP
DVISHLEEGEAPWMPDRELPKSNYSGYWMIKGNNCEKALSSHLTDHQEILIIKEPYKCNI
CGKAFCQSIQLTVHQRIHTGEEPYKCKLCGKVFSRSSQLSGHHRIHSGEEASNKCNICGK
TFRKSSQLILHQRIHTGEKPFKCNYCEKAFRRSSRLTQHQRIHTGEKPYECKDCGKAFHQ
SSGLTQHQRIHTGEKPYKCNDCGKAFRRRSKLTQHQRIHTGVKPYECKDCGKAFHQSSGL
TQHQTIHTGEKPFKCNDCGKVFRRSSKLIQHQRIHTGVKPYECKDCGKAFHQSSQLTLHH
RIHTGEKPFKCSDCGKAFHQSSELTIHQRIHTGEKPYQCNNYCGKAFHGSSHLIRHQRIH
TGEKPYECKDCGKTFRIKVHLTLHERLHSGGKPYKCYECGKDFYWNSQLTIHQRIHTGEK
PYKCNICGKAFPQSSELTRHQRIHTGERPYKCNDCGKAYNQNSELTRHQRSHTGEKPYKC
SNCGKAFNREKSSLTAHQRIHTGEKPYECNYCGKAFCRRSQLTVHQRIHTGEKPYKLYID
EKPYECNYCEKAFHRSSQLTRHQRIHTGEKPYECNYCGKAFRQSSHLTRHQRIHTGEKPY
KCKDCGKGFHQRSELIPHQRIHTGEKPYECSYCQKAFHRSSQLTRHQRIHTGEKPYKCNY
CEKAFHQSSQLTLHQRIHTGEKP
Download sequence
Identical sequences F7G1E0
ENSMODP00000028176 ENSMODP00000028176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]