SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028285 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028285
Domain Number 1 Region: 3-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000378
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028285
Domain Number - Region: 65-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0005
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028285   Gene: ENSMODG00000023088   Transcript: ENSMODT00000029867
Sequence length 607
Comment pep:known_by_projection chromosome:BROADO5:1:695000105:695002174:1 gene:ENSMODG00000023088 transcript:ENSMODT00000029867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDCHHCGKQFPKPFKLQRHLVVHSLEKIYMCTRCPKFYKESRELRGHLSQEHGVKEKPEI
KHTTLYACELCADVMHVIKKSFICSTCNYTFSKKEQYERHMEKHLAEGNRTFKFRGVLRP
GVGSRDGREKKKKEVTSQESMPPHKKRKVTLPISLPGPEAEVTPRPLSPPVLYKSFLEET
LNSPERLSDEEKPEHLIGCLSDHLDKIEDCPLELLQLPPPCLSPLSDSPLSDIPVGYKES
QSVPLLCPEEPKLEQDLPTLPIGRSQEIEENMALHLTPVQNRHTNTRDKPKMNDDRETPG
YLDSPEHTTNENPLESSNKLSCTKTPHSTQPLKDRTASPILNRVTKDSTPQRKTAMNHVP
REAASSTPCPEDGSRPTTLKAKPNQSPQAKDNVGSNVKEGGCSQPKPTSAQLKSETSLLP
TKPDHKDLGISSEKSALSISTKGFSKRQKECKSVGHKGSLVSRENIKGDGKKKKAPEMGR
GEGPRNLKKAEWASNNGSMPSSRRRGTPDNRVSKPRPSATSSQLKKTVPDPYNQKKVETH
HHKRNTKCKKGILRKSFREVRGRTVQGAKPAETHKYRTVESQNNLLSQLFGQKLTSFKIP
LRRDTSE
Download sequence
Identical sequences F7B1C5
ENSMODP00000028285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]