SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028286 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028286
Domain Number 1 Region: 122-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000184
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028286
Domain Number - Region: 195-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000676
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028286   Gene: ENSMODG00000023088   Transcript: ENSMODT00000029868
Sequence length 769
Comment pep:known_by_projection chromosome:BROADO5:1:694999748:695002174:1 gene:ENSMODG00000023088 transcript:ENSMODT00000029868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVQKCMTGLPTCFGEDNAVTQFLNTIMNRKPRPSRGKRSTSKGSKDPKEQESKGSQDIM
EGSGKNKPLAQTNTPANSNFPTVTTASSSSPKVGSPDPGPSGEHPSKVAPMHPQCKDPSR
DCHHCGKQFPKPFKLQRHLVVHSLEKIYMCTRCPKFYKESRELRGHLSQEHGVKEKPEIK
HTTLYACELCADVMHVIKKSFICSTCNYTFSKKEQYERHMEKHLAEGNRTFKFRGVLRPG
VGSRDGREKKKKEVTSQESMPPHKKRKVTLPISLPGPEAEVTPRPLVHRVGNSPDLGDKS
PPVLYKSFLEETLNSPERLSDEEKPEHLIGCLSDHLDKIEDCPLELLQLPPPCLSPLSDS
PLSDIPVGYKESQSVPLLCPEEPKVDSPPRSPTPLSETCKLEQDLPTLPIGRSQEIEENM
ALHLTPVQNRHTNTRDKPKMNDDRETPGYLDSPEHTTNENPLESSNKLSCTKTPHSTQPL
KDRTASPILNRVTKDSTPQRKTAMNHVPREAASSTPCPEDGSRPTTLKAKPNQSPQAKDN
VGSNVKEGGCSQPKPTSAQLKSETSLLPTKPDHKDLGISSEKSALSISTKGFSKRQKECK
SVGHKGSLVSRENIKGDGKKKKAPEMGRGEGPRNLKKAEWASNNGSMPSSRRRGTPDNRV
SKPRPSATSSQLKKTVPDPYNQKKVETHHHKRNTKCKKGILRKSFREVVPKGTPSSLHSP
QKRGRTVQGAKPAETHKYRTVESQNNLLSQLFGQKLTSFKIPLRRDTSE
Download sequence
Identical sequences F7B1B8
ENSMODP00000028285 13616.ENSMODP00000028286 ENSMODP00000028286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]