SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028287 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028287
Domain Number 1 Region: 64-154,232-373
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000000816
Family PP-loop ATPase 0.082
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028287
Domain Number - Region: 180-206
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00165
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028287   Gene: ENSMODG00000004151   Transcript: ENSMODT00000029869
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:1:695739630:695761231:1 gene:ENSMODG00000004151 transcript:ENSMODT00000029869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQVGEDYGGPGPAELQPKLPWPGCEQKCMKCKEGLPVLIIRAGDAFCKDCFKAYYIHKF
RAMLGKNRLIFPGEKVLLAWSGGPSSSSMIWQVQEGLSRESAKRLRFVPGIIYIDEGAVC
GQSPEDRTKTMAEMEQVLQTVGFPYHLVSLEEVFNLPTSVLQPISQGPRGSENTYKEAVD
GFIQQQQQQQQQQQQQQRLQEDHGAQETPVSNSLPRAAHTVALMNLFSSVKTLTAKEELL
QILRAHLILHVARTQGYSKVMLGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDDRHGDVT
MLRPMRDYTLKEIAFYNRMFGVPSVFTPAIDTKAPDKASIHRLMESFILKLQAQYPSTIS
TVYRTSEKLVKAPRNGEATAGPVPSRCLLCVCALDIDSADSATAFGAQTAEHLSQKPLLA
PELPAGAPGRPCCCSRTEGQQGCCQVIRLPSERKEPRASFIEQLCYSCRVNMKDLPFLEP
LPPYLLMESQCRRQRAWVKQEIQEFLFEESEEQT
Download sequence
Identical sequences F7B1B4
ENSMODP00000028287 13616.ENSMODP00000028287 ENSMODP00000028287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]