SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028318 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028318
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 432-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 665-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 178-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 10 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 530-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000249
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 12 Region: 390-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000846
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028318   Gene: ENSMODG00000023091   Transcript: ENSMODT00000029900
Sequence length 722
Comment pep:novel chromosome:BROADO5:2:539663495:539675640:1 gene:ENSMODG00000023091 transcript:ENSMODT00000029900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSIQESLTFKDVAVEFTWEEWRHLDPAQMALHRNVMLENYENLVSIGIPVSKLDLLFLL
KREDVQNQEGEAGTGTCIGIQRCRQDSIPCRTLREGYKFSSHNAPFDSLGDQHGKSHPLV
KRGKGIFPFHNLPFDSWETSMLNLLTYVCQSHNLAHVSWVTVGTSKGFPLNGKSCKRTKK
NFDVHQKFHTERKPFECNQCGKTFAKRAALTVHQRIHTGEKPYECNYCGKAFKERSSLTV
HQRIHTGEKPYECNQCGKAFKYRKSMVEHQSTHTREKPYKCYHCGKTFTQRATLTVHQRI
HTGEKPFECNQCGKAFRYRKSMVKHQSIHTGEKPYKCDQCGKAFIDRSILTVHQRIHTGE
KPYECNHCGKTFKERASLTVHQTIHTGEKPFECNLCGKAFRRRDYLKLHQRIHTGGKPYE
CNQCGKKIAKRAALIVHQRIHTGEKPYECNHCGKTFTERASLTVHQRIHTGEKPFECNLC
GKTFIRRNRLTVHQRIHTGEKPYECNQCGKAFSQKSGLTIHQRIHTGETPFECNQCGKGF
RRRYLLNLHQRIHTGEKPYECNQCGKAFRYRKSMVKHQSIHTGEKPYECYQCGKAFRCRK
SIVKHQRIHTGETPHECNHCGKTFTERASLTVHRRIHTGEKPFECNLCGKTFMRRNRLSI
HQRIHTGEKPYKCKQCGKAFIDRSTLTVHQRIHTGEKPYECNQCGKAFRYRKSMVKHQSI
HS
Download sequence
Identical sequences F7FQI2
ENSMODP00000028318 ENSMODP00000028318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]