SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028325 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028325
Domain Number 1 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 256-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-25
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 115-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 62-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.98e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 11 Region: 218-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000116
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 302-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000612
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028325   Gene: ENSMODG00000023093   Transcript: ENSMODT00000029907
Sequence length 624
Comment pep:novel chromosome:BROADO5:2:539589690:539737288:-1 gene:ENSMODG00000023093 transcript:ENSMODT00000029907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQESLTFKDVAVEFTWEEWRHLDPAQMALHRNVMLENYENLVSIGKQNQPLYIGDGASDS
TWRENLDVHQKIHTGGKPFECNQCGKACRSRNSMVKHQSIHTGEKPYKCKHCGKTFTQRA
TLTVHQRIHTGEKPYECNLCGKAFRYRKDIVKHQSIHTGEKPYKCDQCGKAFTQKASLTV
HQRIHTGEKPFECNLCGKAFIRRARLTVHQRIHTGEKPYECNQCGKAFTQKSALTIHQRI
HTGETPFECNQCGKAFRGRDGLKLHQRIHTGEKPYKCNQCGKAFTHRSTLTVHQSVHTGE
KPYECNQCGKAFRSRNTTLTVHERIHSGEKPFECNLCGKAFTERSTLTVHERIHTVEKPF
QCNQCGKKFTQRASLIVHQRVHTGEKPYECNLCGKAFRLSNHLNVHQRIHTGEKPYECNL
CGKAFTRKVGLTVHQRIHTGEKPFECNQCGKAFRHKYSLVTHQRTHTGEKPYECNLCGKA
FTERSTLTVHQRMHTGEKPYECNLCGKAFTERSTLTGHQRMHTGEKPYDCNFCGKAFRLS
NHLNVHQRIHTGDKPFECNLCGKAFTERSTLTIHQRIHTGEKPYECNLCGKAFTERSTLT
GHQRIHTGEKPYDCNLCGKAFRLS
Download sequence
Identical sequences F7FQ46
ENSMODP00000028325 13616.ENSMODP00000028325 ENSMODP00000028325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]