SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028364 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028364
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-27
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-24
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 384-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 608-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 443-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 664-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.42e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 11 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 12 Region: 127-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000034
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 13 Region: 706-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000828
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028364
Domain Number - Region: 73-122
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.000408
Family Inorganic pyrophosphatase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028364   Gene: ENSMODG00000023099   Transcript: ENSMODT00000029946
Sequence length 771
Comment pep:novel chromosome:BROADO5:2:538668295:538678412:1 gene:ENSMODG00000023099 transcript:ENSMODT00000029946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFQDVAVDFTLEEWRLLSPPQKELYKEVMLENAWNLLSVGLPAPPEDVLSYLEQREAPW
MLEQEGLRSFSPVLEWKPENTFALNGEFNEKDIFHQVIESTHKCWKDLLHKVVDQGGIKC
EKFSERRQCGKTFRQRHKLTIHRRIHTSKKPYECNHCGKTFSWSSELAVHQRIHTGEKPY
ECNHCGKTFSRSSSLAIHQRIHTGEKPYECKQCEKTFRSSSELVVHQRNHTGEKPYECNL
CEKTFNQSSNLARHQRVHSGMKPYECNHCGKTFRTSSELAVHQRIHTGEKPYECNQCEKT
FNQSSNLARHQRNHTGEKPYECNHCGKTFSQSSHLVLHQRIHTGEKPYECNQCGKTFSRS
SSLAIHQRIHTGEKPYECNHCGKTFRSSSELVVHQRNHTGEKPYECNHCGKTFNQSSNLA
RHQRVHSGMKPYECNHCGKTVRSSSELAIHQRIHSGERPYECNHCGKTFRSSSELARHER
IHTGEKPYECNHCGKTFRSSSELAVHHRIHTGEKPYECNHCGKTFNQSSNLARHQRIHTG
EKPYECKQCGKTFRYSSDLAVHQRNHTGEKPYECSNCGKTFNQSSSLARHQRIHTGEKPY
ECNLCGKTFRSSSELAVHQGNHTGKKPYECNHCGKTFRLSSELAVHQRIHTGEKPYECNQ
CGKAFNQRSNLARHQRIHTGEKRCECKQCGKPFRYSSDVAQHQRIHTGEGPYECKQCGKT
TFTVRSRLAIYQRIHTGEKPSESNQWGKQFIWRSTLGLHQRNLRLSHRVLT
Download sequence
Identical sequences F7EXE4
ENSMODP00000028364 ENSMODP00000028364 13616.ENSMODP00000028364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]