SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028402 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028402
Domain Number 1 Region: 744-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 800-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 629-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.43e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 11 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 12 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 13 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 14 Region: 82-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 15 Region: 846-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 16 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-16
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028402   Gene: ENSMODG00000023102   Transcript: ENSMODT00000029984
Sequence length 900
Comment pep:novel chromosome:BROADO5:2:538198109:538264001:-1 gene:ENSMODG00000023102 transcript:ENSMODT00000029984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFQDVAVDFTRGEWRLLSPPQKELYREVMLENARNLLSVVFEYSKYILVLFIKITLE
QREMKKTEKPSQQLPFSTPRIHTGEKPYECKQCGKTFSWNSALAAHQRIHTGEKPYECKQ
CGKTFSQISHLTVHQRIHTGEKPYECKQCGKTFSQSSHFSGHLRIHSGEKPYECKQYGRP
FKHNYSLALHQRIHSGEKPHECKQCGKKFIYSYSLTAHQRRIHTGEKPYECKQCGKTFNR
SCSLGIHQKIHTGEKPYECKQCRKTFRKISSLVRHQRIHSGEKPYECKQCGKTFRNISSL
GRHQRIHTGEKPYECKQCGKTFSRTCSLAQHQRIHTGEKPYECKECGKTFRLSSVLAQHQ
NIHTGEKPYECKQCGKTFSQRSHLDNHQRIHTGEKPYECKQCGKTYRGSSYLAIHQRTHT
GEKPYECKECGKTFRNSSSVAVHQRIHSGEKPYECKQCGKTFRNSSSLGRHQRVHTGEKP
YDCKQCGKTFSRSCSLAQHQRIHTGEKPYECKECGKTFRLSSSLAQHQNIHTGEKTYECN
QCGKTFYGSYYLAIHQRIHTGEKPYECKQCGKAFSQSSSLSKHQRIHSGEKPYECKECGK
TFRSHPSLVYHRRIHTGEKPYECKQCGKAFRGSSYLLIHQRTHTGEKAYECKQCGKEFRG
ILSLAVHQRIHTGEKPYECKQCGKTFSVPEGYSDLAQHQIIHTGEKPYECKQCGKTFRWS
SVLAQHQRIHTGEKPYECKQCGKTFTQSSYLAQHQRIHTGEKPYECKKCGKTFRLRSDLA
VHQRVHTGEKPYECKQCGKTFNQRSHLTVHQRIHSGEKPYECKKCGKTFSQSSYLAQHQR
IHTGEKPYECKQCGKTFSQSSYLAEHQRVHTGEKPYECKQCGKTFSQRSHLTVHQRIHSG
Download sequence
Identical sequences F7BLS2
ENSMODP00000028402 ENSMODP00000028402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]