SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028427 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028427
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 278-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.95e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 177-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000597
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 316-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000333
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028427
Domain Number - Region: 380-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.018
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028427   Gene: ENSMODG00000001573   Transcript: ENSMODT00000030009
Sequence length 406
Comment pep:novel chromosome:BROADO5:1:641647374:641650075:1 gene:ENSMODG00000001573 transcript:ENSMODT00000030009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQGSITFRDVVVNFIKEEWCLLDHSQKEPYKEVMLENVQNLQSVGLTVPRENFVTYFQQ
GELPWLLEQKGQWSSCPEAETNFEVKEMCNNLSLFWSCDFISREIYDADIRINRIPMSDY
EFDETAEKFSQYSVLNQEMAFDWSLNVISHPKSKYLSVKTMILVLIKYFTLERRNLKNVQ
CGKVFTQSGDLSRHQRIHTAEKPYECRQCGMTFTQKCLLARHFRTHTGEKPYECKQCGKA
FIEKGSLGVHQRMHNEEKPYDLPCVTLSRHRGLMAPSTEHMRIHTGEKFYECRQCRKAFT
LRNSLSVHQRIHTGKKPYACRQCGMAFTLRHLASHQSIHIGENLYACHQFNIEIEMESLE
LVQYEIMSSEQTSSRWIPHRKAFSQRSSLISCQRIHSAEKLDECAQ
Download sequence
Identical sequences F7ACM7
ENSMODP00000028427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]