SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028576 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028576
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 148-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 92-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 36-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 10 Region: 605-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 11 Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 12 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 1-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028576   Gene: ENSMODG00000008516   Transcript: ENSMODT00000030160
Sequence length 728
Comment pep:novel chromosome:BROADO5:2:522415970:522419218:1 gene:ENSMODG00000008516 transcript:ENSMODT00000030160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCNECGKGFSQRENLMKHQTTHTGEKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNE
CGKGFSQRENLMKHQTTHTGEKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNECGKG
FSQRENLMKHQTTHTGEKPFKCNQCGNTFHTEEDLRTHQKTHTGEKSFKCNECGKGFSQR
ENLMKHQTTHTGEKPFECNECGKAFGEKRTLSRHQKTHSGVKPFECNECKKAFSRRTDLI
IHQRIHTGEKMFECNVCRKSFTFGDKVLLNRHQKTHSGLKPLKCNECKKTFNQRTSLIIH
QRTHTGEKPFKCNECGKAFTQKAILINHKRLHTGEKPFTCNECGKGFIQKVVLINHQRTH
TREKPFTCSVSGKIYSNSKTAKSQQRIHPGEKPFSCGECGKGFNWRANLNRHQKIHTGEK
PFKCNVCGKAFSEKNYLITHQRTHTGEKPFTCNECGKAFSRRTNLISHQRIHTREKPFKC
SECEKAFSRKKTLKKHQRTHSGDKSFECNVCKKNFSHRGHLVSHQRTHIGEKHFTCSECG
KVFSRRTALIRHHKTHSGEKPFKCTECGKSFRESETLKRHQRIHTGEKPFECNICGKAFT
QRGHMRTLNRHQKTHTGVKPFKCNECKKSFSRRTILIIHQRTHTGAKPFTCNECGKSFSQ
TGHVIRHQRTHTGTKPFECKECGKSFSEKDHLITHQRTHTGEKPFVCDECGKAFSRRTIL
ITHQRTHT
Download sequence
Identical sequences F7D963
ENSMODP00000028576 13616.ENSMODP00000028576 ENSMODP00000028576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]