SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028582 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028582
Domain Number 1 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 302-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 694-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 638-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 750-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.72e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 791-843
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 267-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 348-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 432-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000155
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028582
Domain Number - Region: 198-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000414
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028582   Gene: ENSMODG00000023140   Transcript: ENSMODT00000030166
Sequence length 853
Comment pep:novel chromosome:BROADO5:2:522368770:522387500:1 gene:ENSMODG00000023140 transcript:ENSMODT00000030166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLTPELVTFKDVAVEFTQEEWGHLKLAQRALYRDVMLENYENLVSLGLPVSKLDVISLL
VRGEALWRPEGGGPKSSYKGTLSQKTKFEIKVTSLMQCIYMEESYKTDLPVNIPWHSITA
EPMECDINLKIQKGNQERLSRLITIPQKTTFNEMTAPYYNTLGGGFNLASIFVPWRNPMK
KGFHNKTLEKKVKDFSDLFICNAFSLGKNLSKYDKCKKPFSYQSDLIKFHRTQAGENPHE
DKEGGKAFGRRAGGIRYQKIRIREKNECRKYGKTFSHQKRLIKMKINTQEKPFKCKECGK
GFSQRGNLITHQKTHTGEKPFICKECGKGFSQRGTLISHQRIHTGEKPFECHECGKAFSE
WGSFNRHLRTHTGEKPFECYECGKGFSQRGTLISHQRTHTGEKPFECHECEKAFTSSNGL
KTHQRNHTGEKPFECHECGKAFTEHKVLKIHQRIHTGVKPFECNECGKAFSDNNVLRSHQ
RTHTGEKPFECQECGKGFSQKGTLNSHQRTHTGEKPFECQECGKGFSWKASLIAHQRTHT
GEKPFECHECGKGFRQRANLTTHQRTHTGEKPFECNQCGKAFSKSNILKTHQRIHTGLKP
FECDHCGKAFSDGNVLKSHQRTHTGEKPFECQECGKGFSWRASLITHMRTHTGEKPFECH
KCGKAFSQWGSFNKHQKTHTGEKPFECHECGKGFRQRVNLITHQRIHTGEKPFECHECGK
AFSEKGHLIRHQRTHTGEKSFECHECGKAFVERRSFNRHQRTHTGEKPFECHECGKGFRQ
RVSLITHQRIHTGEKPFECHECGKGFGQKINLITHQRIHTGEKPFECQECGKAFSEKGHL
NRHQKIHARKKFF
Download sequence
Identical sequences F7D8X5
ENSMODP00000028582 ENSMODP00000028582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]