SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028585 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028585
Domain Number 1 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 39-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 336-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-25
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 224-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.88e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 168-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000235
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 117-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000235
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028585   Gene: ENSMODG00000012512   Transcript: ENSMODT00000030169
Sequence length 550
Comment pep:novel chromosome:BROADO5:2:522309979:522324734:1 gene:ENSMODG00000012512 transcript:ENSMODT00000030169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGAPWPWDTAPSLQALAFSQDWSGENEDRMTFEFLTARIQESVTFKDVSVDFTWEEWR
HLDPAQRDLYRNVMLENYENLVSVGISVSTVDMISLLEKRDGPWMPEGEVSGAICPGLIS
HQKTHSGETVFECNESKKGLKEIEYLATQQRIDIEEKPFECNKYGTDFENKVGLITHQKI
HSGETPFACNESKKGLKEIEHLITQQRIDIEEKPFVCHECGKGFRQSGYLIIHQRTHTGE
KPFRCNECGKTFTQRASLITHQRTHTGEKPFICCECGKTFTQRANLITHHRTHTGEKPFV
CSECGKAFTQKINLNIHQRTHTGEKPFACHECGKGFRQSGHLMTHQRTHTGEKPFACNEC
GKAFAQRVSFIIHKRIHTGEKPYICNECGKGFRQSGHLMIHQRTHTGEKPFTCNECGKTF
TQRSNLTSHQRTHTGEKLFACNECGKAFTQKGSLVTHQRTHTGEKQFVCNECGTSFLHRV
TLVIHKRTHTGEKPYSCNECGKGFRQSGHLITHQRTHTGEKPFACHECGKTFTQRANLTS
HQRNHTGDKI
Download sequence
Identical sequences F7D8V8
ENSMODP00000028585 ENSMODP00000028585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]