SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028600 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028600
Domain Number 1 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 443-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 37-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 405-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000156
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 10 Region: 321-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028600
Domain Number - Region: 179-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00893
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028600   Gene: ENSMODG00000008473   Transcript: ENSMODT00000030183
Sequence length 657
Comment pep:novel chromosome:BROADO5:2:522118040:522137498:-1 gene:ENSMODG00000008473 transcript:ENSMODT00000030183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLAAKLGERARPSTAASAAAPPGDSRIVDLEARTAAPVTLRDVAVEFTWEEWRHMEPA
QRDLYRDVMLDNYENLVFIGIPVSKLDIISLLVRGEAPWMPARKGHRIFYEAEEYDVNLE
KPKDNQERQCREVTNIPRIIFNNARLPRYNTFGRHFNTFNIFPDLITSNAFSFWWNLSKS
NKYKKSFSYHSDLIKFHRLHHKRMNTGKPFKCNECGKYFIEKRKLISHQRTHTGEKPFAC
SRCGKSFSQRVHLISHEKTHTREKPFACNECGKGFCQRGHLNRHQRIHSGEKPFECNECG
KGFIRRSHLVTHQRIHTGEKPFVCNECGKTFSERRNLISHQRIHTSGKPFVCSECGIGFR
HRVSLIIHQRTHTGEKPFLCNECGKGFRQRGHLSTHKRTHTGEKPFACNECGKTFSERRN
LFAHRRIHTGEKPFACNECGKGFRCKVSLITHERSHTGGKIFECKECGKSFSWRASLIIH
QRTHTGEKPFACDECRKSFARKASLVIHQRTHTGEKPFVCNECGKGFSQRGHLITHQRIH
TGEKPFECSECRKTFSERRNLITHQRIHTGEKPFACSECGKGFRCKVSLITHQKTHTGEK
HFACNECGKAFSKRAHFIIHQRTHTGEKPFECIECGKAFSVRGSLNRHQRTHAVEKL
Download sequence
Identical sequences F6ZJQ7
ENSMODP00000028600 ENSMODP00000028600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]