SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028619 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028619
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-29
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 175-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 352-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 273-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000828
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028619   Gene: ENSMODG00000007416   Transcript: ENSMODT00000030202
Sequence length 411
Comment pep:novel chromosome:BROADO5:1:591301189:591306209:1 gene:ENSMODG00000007416 transcript:ENSMODT00000030202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQESVTFKDVAVNFSQEEWEQLNPAQRDLYRDVMLENYRNLVSLGLPTSKPDVIFQLEQ
GKEPWFLNLSRAKERELPKNSSLGEVILKPRSHLQSRKFQKVDSLGIMIPVGSAYREVCV
PGDILDSKKENAEEEKRETSLSYERHSKQVLILPQKNSKDQGQEYNQYDEIIDFLSLTQH
QRSHTGESSYECNECGKIFSWKCNLTRHLLTHTGKKPYKCKECGKTFLNHSYLTAHKRIH
TGEKPYECDECGKTFSKHSSRTEHERIHTGEKPYKCNECGKAFRHRSAIMRHRITHTGDS
PYKCNECGKPFLNPSSLMVHERIHTGEKPYECDECRKAFARHSSLSLHQRIHTQEKSFGC
DECGKTFFDFSSLTRHQKTHSGEKPYLCSVCGKAFCSKASIIQHQRRYANE
Download sequence
Identical sequences F6YWH2
ENSMODP00000028619 ENSMODP00000028619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]