SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028624 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028624
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-28
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-26
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-24
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 10 Region: 145-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 507-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000168
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028624   Gene: ENSMODG00000023146   Transcript: ENSMODT00000030207
Sequence length 640
Comment pep:novel chromosome:BROADO5:1:591094993:591134137:-1 gene:ENSMODG00000023146 transcript:ENSMODT00000030207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLFQESVTFKDVTVNFTQEEWEQLNPAQRELYRDVMLENYRNLISLGLPISKPDVIFQL
EQGQEPWMLDVQGTERQASNSKADHFRRNKSARDINGKSHKRSYLEKKKENSEGKILEKS
LSQERGFKNISVNISKNSNKEKSSDCNVCGKTFRHISSLRRHQITHTGERPYECSECGKA
FFDCSSLTIHKRIHTGEKPYECDECGKAFFDRSHLNRHQRIHTGEKHYECDQCGKAFFDR
SSLTQHQKIHSKEKPYECNECGKTFIQKRDLKRHQMTHTGEKPYECGECGKAFSHSSSLR
RHEMTHTGEKAYECDECGKAFSQKSILTRHQLTHTGEKPYECNECEKAFFGLSSLIRHQR
THTGETPFECNECGKAFFDRSSLTQHQKIHSKEKPFECNECGKAFNQRSHLNRHQRTHTG
EKPYECSVCGKVFSSKSSLRRHQITHTGERPYECNECGKAFFDCSSLTIHERIHTGEKPY
ECDECGKAFFNCSNLTRHQRIHTGESPYKCNECGKAFRHSSSLRRHQMTHTGQRPYECNE
CGKAFFDRSTLIIHERIHTGEKPYECEECGKAFFDRSSLTQHQKIHSKEKLYECSECGKA
FNLRRHLNRHQITHTGEKPYECSVCGKVFSRKSSVIQHQR
Download sequence
Identical sequences F6YVT7
ENSMODP00000028624 ENSMODP00000028624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]