SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028625 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028625
Domain Number 1 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-25
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 49-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 773-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 717-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-23
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 661-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 815-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 400-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000298
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 13 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000392
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028625   Gene: ENSMODG00000008457   Transcript: ENSMODT00000030208
Sequence length 878
Comment pep:novel chromosome:BROADO5:2:522019708:522040325:-1 gene:ENSMODG00000008457 transcript:ENSMODT00000030208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRKEWKHGRDVAVTCQERALVSPDSALLQVSSLEKEEGGTSGVLADRFQVSVTFEDVA
VEFTWEEWRYLDLGQRTLYRDVMLENYENLVSIGIPVSKPDLLFLLKRDKGQGVKERGGK
GKRLTQPSDRARRKNTFGTKVSSLKQVISSEVLSDQKVGKNMVWDSKMKESGICSNNLEK
KKDQQERQSRQVAIGAEISMNKVNVPQCNTFKRSFRLKSSLVAPQRRALQKILCKFKGLA
MSFRKLPNICDPFFLGRSLYKYTRWKKPFRYHSDLIKLKGITHPKKKPFECDECEKAFSR
KGHLVCHQRTHTGEKPFECNECGKAFSYKKSLVIHQRTHRGEKPFGCNECGKAFSWKESL
ITHQRTHTGEKPFECNECGKTFIIRQSLIKHQRVHTGEKPFQCNECGKAYTCNSTLIVHQ
RIHTGEKPFECNECGKAYTRKGHLVSHQRTHTREKPFECNECGKAFSHKTSLVVHQRTHR
GEKLFECNECGKTFMEKNSLIRHGRIHTGEKPFECNECGRTFSFKDSFIRHQSIHSGEKP
FECNECGKAFKLKKSLISHQSIHSGEKPFECNECGKTFSMRNNFRRHQRTHTGEKLCQCN
ECGKAYTCKASLIVHQRIHTGEKPFECNKCGKTYIWKGHLVSHQRTHTGEKPFECNECGK
AFSYKTSLVVHQRTHRGEKPFKCNECGKTFIEKQNLIRHGRIHTGEKPFECSECWRTFSC
KESLISHQSTHTGEKPFECNECGKAFSLKKSLISHQRTHTGEKTFECNECGKTFSIRKSL
KRHQRTHTGEKPFECNECGKAYTYNSILTIHQKTHTGEKPFECSECGKAFRQKVHLVYHQ
RIHTGEKPFECNECGKGYRQKGHLVCHQRTHNREKPFE
Download sequence
Identical sequences F6YVS9
ENSMODP00000028625 ENSMODP00000028625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]