SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028639 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028639
Domain Number 1 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-26
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 170-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 114-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 61-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 466-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028639   Gene: ENSMODG00000023149   Transcript: ENSMODT00000030222
Sequence length 527
Comment pep:novel chromosome:BROADO5:2:521805003:521817486:-1 gene:ENSMODG00000023149 transcript:ENSMODT00000030222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESLTFKDVAVEFTWEEWRHLGPAQRALHTNVMLENYENLVSIGKQNQALCIGDGACDST
WRENLDVHQKIDTGGKPYECNQCGKAFIRRSRLTVHQRIHTGEKPFECNQCGKTFRGRDG
LILHQRIHTGEKPFECNQCGKAFRGRDGLILHQRIHTGEKPFECNQCGKTFAKRAYLTVH
QRIHTGEKPFECNQCGKAFIRRSSFTEHQSIHTGEKPYECNQCGKAFRCRNNMVKHQRLC
NGEKPFECNQCGKAFRGRDVLILHQRIHTGQKPFDCNQCGKAFSQKSTLIVHQRIHTGEK
PHECNHCGKAFRCRKRLVAHQRIHTGEKPFECNQCGKAFRCRKRLVAHQSVHTGEKPYEC
NQCRKTFTHKFGLNLHQRIHTGETPFECNQCGKAFRGRDGLILHQRIHTGEKPYKCNQCG
KAFSQKSTLTVHQSIHTGEKPYECNQCGKAFRCRNNMVKHQRLCNGEKPFKCNQCGKAFR
GRDVLILHQRIHTGQKPFDCNQCGKAFTQKYGLTVHQRTHTGVKPYE
Download sequence
Identical sequences F7GJH4
ENSMODP00000028639 ENSMODP00000028639 13616.ENSMODP00000028639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]