SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028682 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028682
Domain Number 1 Region: 130-264
Classification Level Classification E-value
Superfamily Acid proteases 1.3e-42
Family Retroviral protease (retropepsin) 0.0000705
Further Details:      
 
Domain Number 2 Region: 8-139
Classification Level Classification E-value
Superfamily dUTPase-like 1.01e-21
Family dUTPase-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028682   Gene: ENSMODG00000023158   Transcript: ENSMODT00000030265
Sequence length 283
Comment pep:novel chromosome:BROADO5:1:585935361:585936209:-1 gene:ENSMODG00000023158 transcript:ENSMODT00000030265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLSSSLTRATAGSAGLDLCASTTRILTPEEGPIVLPTGKFGPPPPGMFFLIIGRALTTL
QGVVVHPTLVNNDYKGEIKIIIESPHGPVTIPAGRCLAQALPLPMIGNFPAVAHTRDPSS
PGSSNIYWVQQLTESQPTLQLKIEGKTFTGLLDTGADSTVISQAHWPRSWPLQPSSTHLS
GIGQVQDTLQSSKVLTWQDTEGNRGTTRPYVVAGLPVNLWGRDILTQMRLLMVSPSDPVT
TMMLKSGYLPGKGLGKREQGLPHPISFRPHKERKGLGLQSFLQ
Download sequence
Identical sequences F7FZU3
ENSMODP00000028682 ENSMODP00000028682 13616.ENSMODP00000028682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]