SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028686 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028686
Domain Number 1 Region: 246-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-17
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028686   Gene: ENSMODG00000023162   Transcript: ENSMODT00000030269
Sequence length 335
Comment pep:known_by_projection chromosome:BROADO5:1:584798631:584799838:-1 gene:ENSMODG00000023162 transcript:ENSMODT00000030269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPPLSPSPLSTENVMDIGLANEKPNQELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQ
DNIISLMSAGILGVPPASGALSTQTSTASMVQPQGEVEPMYPALPPYSNCSDLYSEPVSF
HDPQGNPGLAYSPQDYQSAKPSLDSNLFPMIPDYNLYHHPNEMGSVTEHKPFQSMDPIRV
NPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAE
GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEPHFS
PPQWGTPPRRRRGRALASPWTHGSQLPCDASYPPP
Download sequence
Identical sequences F7FZS6
13616.ENSMODP00000028686 ENSMODP00000028686 ENSMODP00000028686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]