SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028701 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028701
Domain Number 1 Region: 24-150
Classification Level Classification E-value
Superfamily POZ domain 2.09e-26
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-18
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028701
Domain Number - Region: 403-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00012
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028701   Gene: ENSMODG00000010600   Transcript: ENSMODT00000030283
Sequence length 640
Comment pep:known_by_projection chromosome:BROADO5:2:517594743:517597328:1 gene:ENSMODG00000010600 transcript:ENSMODT00000030283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEADVSLNPGGSTGQTMLDAMEAPGHSRQLLLQLNSQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGADGGAAAAAPG
AEPSLGAVLAAASYLQIPDLVSLCKKRLKRHGKYCHLRGAGAGGGYAPYGRPGRGLRATT
PVIQACYPGGAPSGPPPPPASAAELPPGAEAPVNTHCAERRCSPLCGLDLSKKSPPGSAA
GLERPHPGEREREAPSRHDSSPPGAAYKEPPLSLALPLPLPLPLPFQKMEEAGQPLDPFR
PGGSPGPEPPGRPDGPALLYRWMKAEPGLEPADEGDSPGGPPLPLPPPPRYPGVGLDGPG
PDADDYKSSSEETGSSEEPSPGGGHLARYHCPHLAYGEPESFGDNRYVCIPCDKGFPSSE
QLNAHVEAHVEEEEALYERAEAAEEAASYKDPATLRQHEKTHWLTRPYPCTICGKKFTQR
GTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLI
SHMKMHALDFPEGVFAVARLTAEQLGLKQQDKAAAAAELLAQTTHFLHDPKAALESLYPL
AKFTAEQLGLSPDKAAEVLSQSAHLAGGPDGRTIDRFSPT
Download sequence
Identical sequences F7DT27
ENSMODP00000028701 13616.ENSMODP00000028701 ENSMODP00000028701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]