SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028901 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028901
Domain Number 1 Region: 767-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000681
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 2 Region: 887-939
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000013
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 825-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000142
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 4 Region: 1026-1076
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000511
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028901
Domain Number - Region: 604-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00328
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028901   Gene: ENSMODG00000018857   Transcript: ENSMODT00000030478
Sequence length 1141
Comment pep:known_by_projection chromosome:BROADO5:2:496461344:496470911:1 gene:ENSMODG00000018857 transcript:ENSMODT00000030478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLSNGECRSRRLRPGAQRVLREGERLYSGEAGSSRGKKRRLRERWRQQWLQELGKDRI
VSAWPGTGTSVGPTPIMGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEESEGPGAHGKAE
PSGGASSGEGPGAAGDRSAGPAQPSEHSLPHPDISAVSVIVKNTICPEQPDSMGGGSGGD
GARAGLGPKEGPVGPRLLQNGFGGPEPPPPRAARSPVPPSGESWKDKAGEGKPSLDLFAH
FGPEPGDPDPLPPSAPSLSRERALTSPSFSTPFELSQENGPSLLPPDSSPPSGTTEPGSD
SPRHPSGSGWSAVASSPKEVGILPNSSPPQLGGAPFFKSLPASGNPPSSPKPLGTSPPRD
EEDDEGTADKSAPDTPQSPSSGAEAADEDSNDSPASSSSSRPLKVRIKTVKTSCGNITRT
VTRVPSDPDPPAALPSIEGALPADPGLPKVPPGASTPESPKVVSVQLGDGTKLKGTVLPV
ATIQNASTAMLMAANVARKAVVLPASASPKAVAKSVLGLAPQGLPKAEGRAASGSGGQKV
NGASVVMVQPSRPAGAGGTVISRTQSGLVEAFNKVLNSKNLLPAYRPNLCPPAEAGLALP
PAGYRCLECGDAFSLEKSLARHYDRRSMRIEVTCNHCARRLVFFNKCSLLLHAREHKDRG
LVMQCSHLVMRPVALDQMVGQPDITPLVPVAAPPVTPQPPATPGKGEGAAESPALPLLAE
LPPASATTSTYTCFRCLECKEQCRDKAGMAAHFQQAGPPAPGVASNVCPSCPMMLPSRCS
LSAHQRMHKSRPPHVCPECGGNFLQANFQVHLREACLHFSRRVGYRCPSCSVVFGGVNSI
KSHIQTSHCEVFHKCPICPMAFKSAPSAHAHLYTQHPGFSSQQAKLIYKCAMCDTVFTHK
PLLSSHFDQHLLPQRVSVFKCPSCPLLFAQKRTMLEHLKNSHQAGRLGEEAGGKGTGGTL
LTPKPEPEELALSRGRAGPPTEESSSSSEEEEPPSSPEPPRPAKRSRREPGGNRGNRGRG
GGLGGWTCGLCHSWFPEQDEYVAHMKKEHGKSVKKFPCRLCERSFCSAPSLRRHVRVNHE
GIKRVYPCRYCTEGKRTFSSRVILEKHVQGRHRPPRLGTQSPSQAGGLARGGTQQTSLHQ
P
Download sequence
Identical sequences F7CMW7
ENSMODP00000028901 ENSMODP00000028901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]