SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029316 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029316
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-39
Family SCAN domain 0.00007
Further Details:      
 
Domain Number 2 Region: 987-1043
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 763-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 902-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 725-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 805-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000493
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 949-980
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000981
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000029316
Domain Number - Region: 220-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0248
Family KRAB domain (Kruppel-associated box) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029316   Gene: ENSMODG00000017129   Transcript: ENSMODT00000030890
Sequence length 1062
Comment pep:known_by_projection chromosome:BROADO5:4:430054212:430083338:-1 gene:ENSMODG00000017129 transcript:ENSMODT00000030890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTLESPVQSPTEQEGLLIVKLEEDSSWKQESALWGDELDLEISRQRFRQFRYQEVSGP
HQAFSQLWELCCRWLRPEVRMKEQILELLVLEQFLNILPREIQSWVREHHPESGEEAVAL
VEDWQINPRKPGQQITANAHGQEVASKESRPSGAVKDLEIEPTDCQSKGPSQKQLLQNPC
PGQRQLKEESRPLKENVVLAPRVPALPKVGRVGDWEMAAESQGSATEEDASLCFSASHGN
PVKKTTHKDAMRESHRNELSLVLKPSRISWPEKRRDPCIPNLLDSGKRENPGDHSTFEEQ
VRLGQTSSRKEVKSWAEQEQWDVEDMRVTGVHWSYEETKTFLAILGESPFSEKLRTCHQN
RPVYRAISERLRERGFLRTLEQCRYRIKNLLRNYRKAKSSHPPGTCPFYEELDTLVKARA
AVRAADISEEAAGLPRLGDSDAETEEQEEGSWEHEAATEAMTAEDCNGDEVVIEEPIQGP
KMSGGPTFFQSRIGVHWGYEETKIFLAILGESPFSKKLQTCHQNSQVYRAIAERLRQRGF
LRTLEQCRYRFKNLLRSYRKAKSSQPPGVCPFYEELDTLMRARALLRSARFPERPGTRDA
EEHNQEAWRQEEEEAAKEDRGSDVPTQHFKTHNTVTPFKSCIGLDMKCENEEQNSKQEVS
EELHKTLSKHFEEDGNQIVWEKDCEDEYESGRQCESPSEEQWEKCGSEEDLEKLIDHQGL
YLAEKPYKCNTCVKSFSRSSHFIAHQRIHTGEKPYKCFECGKSFSDRSNLNTHQRIHTGE
KPYKCLECGKSFSDHSNLVTHQRIHTGEKPYKCSECWKSFNQSSNLIKHQRIHMGGNTDR
YEHGESFANNPSLKAHLKNHTGEKISEQLEGENNFSMSLTCPGPQRADSGEKPFECHECG
RSFSKSSALTSHQRIHTGEKPYECAECGKSFSKSSTLTNHQRVHTGEKPYKCVDCGKCFS
ERSKLITHQRVHTGEKPYKCLECGKNFRDRSNLITHHRIHTGEKPYRCGECGKCFNQSSS
LIIHQRIHTGEKPYKCTECGKDFNNSSHFSAHRRTHTGHKAM
Download sequence
Identical sequences F6WPG6
ENSMODP00000029316 ENSMODP00000029316 XP_007493030.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]