SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029328 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029328
Domain Number 1 Region: 34-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-35
Family SCAN domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 765-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 807-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029328   Gene: ENSMODG00000017132   Transcript: ENSMODT00000030902
Sequence length 867
Comment pep:novel chromosome:BROADO5:4:430031677:430047965:1 gene:ENSMODG00000017132 transcript:ENSMODT00000030902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVVAPSHQEEFLLVKLEEDSCLGDDPNFWGCDPDSEASRQHFRQFQYEEFTQPHEVLF
QLRELCHLWLKPEKRTKEQILELLVLEQFLSILPEKLQTWVWDQRPKNSEEAVTLVETWQ
KEPKIPDQWGQEVLSELPAPLGTAQEPRSFQLDSAEIKPEGASQQEGTQSPYREPLEQLS
PMEEPKPLQKSGSLALQDSDLPKMKSFGDYKLVSGSQEAPGHRSPVQDLCKDSEGKDYGN
EFLKDPKSKVTHQEKSGESSWNTDLHSLEERESSKDSYPNKDQGNPYQTPAKKEEKGWED
QELGSSEDGKYAGVHWGYEETKIFLAILSEASFSEKLRTCHRNSQVYRAIAERLQEHGFL
RTLEQCRYRFKNLQTSYRKARTSHPPGTCPFYEEIAALMHARAAIKPTYTVKEIICPLEK
TSGDSDSQGQEPEDWEQGNPWKGPTAKDYEKNEMSLKVFTQEPKGSRATALFQSRTGVHW
GYEETKAFLAILSESEFYEKLRTRHPNRQVYRAIAERLREKGFLRTLEQCRTKFNSLQTS
YRKAGSSHAPETCVFYEEMDALVNAHTAPEAASILKEVTHHARQASSDADPEEQEQDSWH
SEETLEDCDSDEAATKEAKNPNPGLFPKETQKQSISEKRQPHESEGDVPQLPNGEENREN
EYKPEGPLERDMGERQGKLTSKEDVPKPSTQKGSSAEGKPYKCLECEKSFSWRSHLATHQ
RIHTGEKPYKCLECGKSFSWRSHLNTHLRIHTGEKPYKCLDCGKSFSDGAGLTAHRRIHT
GEKPYQCEACGKSFRLSPSLVVHQRIHTGEKPYKCSECGKGFNNSSHFSAHWRTHTGEKP
HECPECGKSFSKGSALNKHQRIHMREK
Download sequence
Identical sequences F6W9F0
ENSMODP00000029328 ENSMODP00000029328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]