SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029449 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029449
Domain Number 1 Region: 24-89,118-143,230-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000935
Family Shikimate kinase (AroK) 0.079
Further Details:      
 
Domain Number 2 Region: 390-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000022
Family HkH motif-containing C2H2 finger 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029449   Gene: ENSMODG00000017650   Transcript: ENSMODT00000031024
Sequence length 457
Comment pep:known_by_projection chromosome:BROADO5:4:423778121:423858031:-1 gene:ENSMODG00000017650 transcript:ENSMODT00000031024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMAAAAAARAGPGTRGLRGPLPLVVILGATGTGKSKLALQLGQQLGGEIVSADSMQV
YEGLNIITNKVSPQEQRLCQHHMISFVDPLVMNYTVVDFRNKATALISFKKAGSCNIFAR
EKIPIIVGGTNYYIESLLWKVLINTKEICKEEKVIDRKMELEKMDGHELHYRLSQVDPEM
AAKLHPHDKRKIARSLQVFEETGISHSELLSRQHAEEGGGPLGGPLKFSNPCIFWLHADQ
AVLDQRLDKRVDEMIAAGLLEELKEFHRRYNREKVAENCQNYQHGIFQSIGFKEFHEYLI
SDDQCSPETSNLLLTKGIEALKQVTKRYARKQNKWVKNRFLSRPGPNVPPIYGLEVTDPL
KWEESVLGPALQIVGSFIQGKQPVATPIRMQCDVNENKRSHHRCELCDRIIIGDREWAAH
TRSKSHLHQLKKRRVDPDTCATLPSQSHFPGPDERTL
Download sequence
Identical sequences F6R649
ENSMODP00000029449 ENSMODP00000029449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]