SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029592 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029592
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-27
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 570-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 11 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-21
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 12 Region: 783-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 13 Region: 196-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000112
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029592   Gene: ENSMODG00000018260   Transcript: ENSMODT00000031166
Sequence length 836
Comment pep:novel chromosome:BROADO5:4:415270529:415319430:1 gene:ENSMODG00000018260 transcript:ENSMODT00000031166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVLLLARSQESVTFKDVAVNFTREEWGQLDPSQRDLYRDVMLENYGNLVSIGLPVSKP
DVISQLERGNAPWIPEEEFARSTCLDSFSLETKDEIEYSSPKQTRCTGISTEGLRKEITW
DSKMRENLEYNVKLERQENNQEKQYRQVTHTLRKVSSDYDTLVRSFSPGSVFVPQQRVTT
GKSLLKYNRISVGKKLSKYNKYRKPFSYHSDLIQFRITNSGDKSYICHECGKAFGQRRYL
IEHQRIHTGQKPHKCDECGKAFIQRGNLTSHQRIHTRERPFECKECGKTFSQRGHLTEHQ
RIHTGEKPFECKECGKAFSHRGHLAEHQRIHTGEKPFACNECGKAFSHRTSLIYHHRIHT
GEKPFKCNECGKAFSQRGNLTEHQRIHTREKPFECNECGKAFSHRGHLTTHQSTHSSEKP
YLCNECGKTFSQRGNLIEHQRIHTGEKPFECNECGKTFSRRAYLPEHQRIHTGEKPFQCN
ECGKAFSHKGSLTEHQRIHTGEKPFQCNECGKTFIKNARLAQHQKIHTGEKPFECTECGA
MFSQEERLIEHQRRHAGEKPFECKECGKFFSRKGYLTEHQRIHAGEKSFECKECGKFFSR
KGYLTEHQRIHAGDKSFECNECGKAFSQRKYLTQHQKIHTGEKPFECNECGKAFRQRGHL
TAHQSIHTAEKPFECNECGKAFRQRGSLTEHQRMHAGEKPFECNECGKAFSHRSSLTEHQ
RIHAGEKPFECNTCGRAFTHRKSFIYHQRLHSGEKPFECNECGKAFSDNSYLTLHMRIHT
GKKPYKCNHCGKAFSQRGNLTEHQRIHTGEKPFECTECGKAFTHRKSLIYHQRIHA
Download sequence
Identical sequences F6TRL6
ENSMODP00000029592 XP_007492807.1.35504 XP_007492808.1.35504 XP_007492809.1.35504 ENSMODP00000029592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]