SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029653 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029653
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 153-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 47-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 339-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000122
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 199-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000547
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029653   Gene: ENSMODG00000023367   Transcript: ENSMODT00000031226
Sequence length 452
Comment pep:novel chromosome:BROADO5:3:526956420:526995175:-1 gene:ENSMODG00000023367 transcript:ENSMODT00000031226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRIYSLWASEEEVSLLWDSHALKDPSLAQAETPEPEEMTPRTLRSPSQGSITFKDVTVD
LTQEEWCLLDHSQKELYLEVMLEMVQNLLSVGLPVPREYCTSCFQQGKTPWLREQKDSCP
GGIAFDYSLDLIRYSKSKWVEVDSVNDKVGRLFSQNSELASHQIIHLGEKPYECKECGKG
FTWKKSFAAHQRIHTGEKPYECKQCGKAFMQRGSLAAHHRIHNGEKPYECNHCGKAFTQM
SSLAAHQRIHDGEKPYECNHCGRAFITRTSLTKHEKIHTGEKPYECKQCGKAFTQRGHLV
AHKRIHSGEKPYECKQCGKAFTERGSLARHQRIHTGEKPYECKHCGKAFTQMSSLAAHQR
IHDGEKPYECNHCGRAFITRTSLTKHEKIHTGEKPYECKQCQKAFTQRGHLVAHKRIHTG
EKPYECKQCGKAFTQMGSLAAHQRIHTGEKPY
Download sequence
Identical sequences F6XKA3
ENSMODP00000029653 ENSMODP00000029653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]