SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029658 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029658
Domain Number 1 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 703-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 759-816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 801-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 11 Region: 35-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 12 Region: 200-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 13 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029658   Gene: ENSMODG00000023368   Transcript: ENSMODT00000031231
Sequence length 854
Comment pep:novel chromosome:BROADO5:3:526830220:526847732:-1 gene:ENSMODG00000023368 transcript:ENSMODT00000031231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKLRLFVEGPGSRRSMNEVPHDCILREICDSDIQGSLTFKDVAVDFTQAEWCLLDHSQ
KELYLEVMLENVQNLLSVGLPVPREYCASCFQQGKTPWLLEQKGLRSACPVKEMSTKLRI
FVQESDPKRWMNDGSHDFVLREISDSDMKINKNLKSEREFDYPSEKILNQYMKVTSGNDY
CQDSQYSKCFPEEEEVEKPFSQNSDLAAHQIIEAEEKTFECKHCGKAFIERGILTKHQRM
HTGEKPYECKECQKAFRERGSLTKHQRIHTGEKPHECKQCGKAFPHCKSLAMHQLIHSRE
KLYECKQCGKTFKKQGSLVVHHRIHSGEKPYKCKHCGKAFTQRSHLTAHQSIHTGEKPYE
CKQCGKAFPRSSSLATHQLIHTGEKPHKCKHCGKAFTQRNCLAKHQRIHSGEKPYECKQC
GKAFPHCKSLAMHQLIHSREKLYECKQCGKTFKKQGSLVVHHRIHSGEKPYTCKHCGKAF
TQRSHLTAHQSIHTGEKPYECKQCGKAFPRSSSLATHQLIHTGEKPHKCKHCGKAFTQRN
CLAKHQRIHSGEKPYECKQCGKAFPRSSSLATHQLIHTEEKPHKCKHCGKAFIQRNCLAK
HQRIHSGEKPYTCKHCGKAFTQRSHLTAHQSIHTGEKPYECKQCGKAFPRSSSLATHQLI
HTGEKPHKCKHCGKAFTQRNCLAKHQRIHSGEKPYQCKQCGKAFTQKSHLAAHQSIHTGE
KPYQCKQCGKAFPYSNSLATHQLIHTGEKPHECKQCGKAFPRSSSLATHQLIHSGEKPHK
CKHCGKAFTQRNCLATHQLIHSGEKPYECKQCGKAFTQRSHLAVHQSIHTGEKPYQCKQC
GKAFTQRSRLAAHQ
Download sequence
Identical sequences F6XK61
ENSMODP00000029658 ENSMODP00000029658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]