SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029665 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029665
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 707-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.97e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 819-876
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 763-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 651-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 11 Region: 118-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 12 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 13 Region: 865-917
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 14 Region: 35-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 15 Region: 72-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 16 Region: 221-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000835
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 17 Region: 473-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000571
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029665   Gene: ENSMODG00000023376   Transcript: ENSMODT00000031239
Sequence length 919
Comment pep:novel chromosome:BROADO5:3:526728778:526796925:1 gene:ENSMODG00000023376 transcript:ENSMODT00000031239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKLRHFVEGSGPQRCMNGVPHDFILREICDSDIQGSLTFKDVAVDFTQEEWCLLDHSQ
KELYLEVMLENVQNLLSVEKPFECKQCGKAFKQRGSLVVHYRIHSGEKPYECKHCGKAFK
QSNHLVAHQNAHSGEKHYECKHCGKDFSREGSLTRHQKIHTGEKPYECKQCGKAFMLSCY
LVAHQRIHTREKPYECKQCGKAFIERRYLDKHQRIHTGDKPYECKQCGKAFTRSSSLATH
HLIHSGEKPHECKHCGKAFTERRSLAKHQRIHTGEKPFECKECGKAFIERGTLTKHQRIH
TGEKPFECKQCGKAFIYRVSLTKHQKIHTLEKPYECKQCQMAFRERGSLTKHQRIHTREK
PFVCKQCGKAFQHSRSLATHQLIHAGEKPYECKQCGKTFTRRGSLVEHHRIHSGEKPYEC
KHCGKAFTQRSHLAAHQRIHTGEKPYECKQCGKVFTYSGSLSKHQKIHTGEKPYECKQCG
KAFIERGTLTKHRGIHNGEKPFVCKQCGKAFTYTVSLAQHQLIHTGEKPYECKQCGKTFP
RSSSLATHQLIHTGEKPFECKYCGKAFTQRSHLVAHWSIHTGERPYECKQCGKTFPRSSS
LAKHQLIHTGEKPYKCKHCGKAFTQRSHLAAHQGIHTGHKKPYKCKQCGKAFKRRGSLVV
HHRIHSGEKPYQCKHCGKAFTQRSHLVAHQSAHTGEKPYECKHCGKAFTERGSLTRHQKI
HTGEKPYGCKQCGKAFMQSRYLAAHQRIHTGEKPYECKQCGKAFIERRSLAKHQRIHTGE
KPYECKQCGKTFTYNSSLATHQLIHSGMKPYECKHCGKAFTERRSVAIHQRIHTGEKPYE
CKQCGKAFIERGTLTKHQRIHTGEKPFVCKQCGKAFTYRGSLAKHQKIHTGEKPYECKQC
QKAFRERGSLTKHQRIHTG
Download sequence
Identical sequences F6X371
ENSMODP00000029665 ENSMODP00000029665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]