SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029670 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029670
Domain Number 1 Region: 45-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 101-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 381-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029670   Gene: ENSMODG00000023371   Transcript: ENSMODT00000031243
Sequence length 430
Comment pep:novel chromosome:BROADO5:4:413878769:413880058:1 gene:ENSMODG00000023371 transcript:ENSMODT00000031243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIHTGEKPFKCHDCGKAFIRSSHLLQHQRIHTDEKPFKCDECGKAFNQNSNLLQHQRIHT
GEKPFKCDDCGKAFNRNSNLLQHQRIHTGEKPFQCNDCGRTFNQNSNLSVHQRIHTSERP
FQCNDCGKAFNRSSHLLQHQRIHTGEKPFQCHDCGKAFSQSSHLLQHQRIHTGEKPFQCH
DCGKAFNQNSNLSVHQRIHTGEKPFQCHDCGKAFKQISHLFHHQRIHTGEKPFKCNDCEK
AFNRSSNLLKHQRIHTGEKPFKCDDCGKAFIRSSTLLQHQRIHTGEKPFKCDDCGKVFSH
RSKLIIHQRIHTGEKQFQCHDCGKAFNHNSHLLQHQRIHTGEKPFQCHDCGKAFNQNSHL
LQHQRIHTGEKPFHCHDCGKAFNQSSHLFQHQRIHTGEKPFHCHDCGKAFNQNSNIYVHQ
RIHTGEKPFK
Download sequence
Identical sequences F6X2S1
ENSMODP00000029670 ENSMODP00000029670 13616.ENSMODP00000029670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]