SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029677 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029677
Domain Number 1 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.68e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 145-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000163
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 313-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000247
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 11 Region: 229-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000315
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029677   Gene: ENSMODG00000018865   Transcript: ENSMODT00000031251
Sequence length 509
Comment pep:novel chromosome:BROADO5:4:413695345:413697291:1 gene:ENSMODG00000018865 transcript:ENSMODT00000031251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEKFYKCPQCRKAFNKSSKLILHQRIHVGENPNECNDCGKGFHHRSKLNIHRRAHTRKN
PYQCNDCGKMFINDSKHILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKC
DDCGKAFNQNSQLLKHQRIHTGEKPFKCNDCGKTFNQNFNLSVHQRIHTGEKPFKCDDCR
KAFNQSSHLLQHQRIHTGEKPFKCHDCGKAFIRSSTLLQHQRIHTDEKPFKCDDCGKAFY
QNSHLLKHHRIHTGEKPFKCNDCGKTFNQSSHLLQHQRIHIGEKPFKCNDCGKAFSQSSH
LLQHQRVHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCHDCGKAFIRSSSLLQH
QRIHTDEKPFKCDDCGKAFNHDSNLFQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQRIH
TGEKPFQCHDCGKAFNQRSHLLQHQRIHTGEKPFKCNDCGKAFSQSSHLLQHQRVHTGEK
PFKCNDCGKAFSQRSKLIIHQRIHTGEKP
Download sequence
Identical sequences F6X2K1
ENSMODP00000029677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]